0DXU4QY i@Y_ UUb - Daily Pioneer
←
→
Page content transcription
If your browser does not render page correctly, please read the page content below
84/4U 8+-*4U9962=46
7`]]`hfd`_+ 0DXU4QY\i@Y_^UUb VQSUR__[ S_] TQY\i`Y_^UUb
4bcPQ[XbWTS '%#
>cPZWaVSR4`][
34;78;D2:=>F 17>?0; 17D10=4BF0A
A0=278A08?DA 270=3860A7 347A03D=
7H34A0103 E890HF030
;PcT2XchE^[ $&8bbdT&%
;D2:=>F5A830H
eYVa
aZ`_VVc ;D2:=>F k5A830H k
7`]]`hfd`_+ /CWT3PX[h?X^]TTa UPRTQ^^Z R^\ SPX[h_X^]TTa X]bcPVaP\ R^\ SPX[h_X^]TTa 84/4U 8+-*4U9962=46
4bcPQ[XbWTS '%#
@A:?:@?) H@C=5"# DA@CE"% ?dQ[XbWTS5a^\
B0H1H4C>A40;8CH CA>D1;43DB 278=0C84B5024 274;B40140C0C;4C82> 34;78;D2:=>F 17>?0;17D10=4BF0A
50:48BC74=4FA40; 8=270
;D2:=>F k5A830H kF ing to over Rs 1,84,000 crore from IR_TU LNMVNN H0\ PL]
I have change my name =4FA42>A38=BD60A20=4B42C>A various banks in the last four years, LNRM99N GNI\G GV RK
ith the aim to double the income of The Uttar Pradesh government has set a new record in the state by paying arrears said Additional Chief Secretary PLGV8Q] LIMOM W\ V MNV0@
Suleman to Suleman Khan S/o
Irfan Khan for future purpose
Shahbadi Paliagoa Faizabad.
W farmers, the Yogi Adityanath gov-
ernment has taken concrete steps to
to sugarcane farmers and even clearing the dues of the tenures of Samajwadi Party
and Bahujan Samaj Party governments. According to official data, over 97 per cent
(MSME and Export Promotion)
Navneet Sehgal. "With invest-
[NV0N [NV0N E= 9V80IMD[ IXIRQN
OZSXNYXT+NRK4HNV# =D %VGQV NMNVD OVIX(XI\I>NU
bring new technology in agriculture and (Rs 34847.60 crore) of sugarcane payment has been made till February 24 for the ments to the tune of Rs 1,84,000 GN =JVUT OK\F8QIXIRQN VD QNV+NN[NVD HVD IQXNDG
at the same time provide all facilities to crushing season 2019-20. In the last four years, the Yogi government has paid Rs crore coming into the MSME sec- GNVFWVUGYNHI8 UGK
NOTICE the farmers, vis-à-vis irrigation and mar- 1,21,613.85 crore of the total cane price from March, 19, 2017 till February end. tor, we are ready for a big take-off," WNUKJ6$Y N
keting of their produce. This is a record. Along with the payment, the government has placed emphasis on said Sehgal, while claiming that @#E=9KOK[NV0N# IR_TU
My name is Subhas Chandra and As a major step, the Uttar Pradesh modernisation of old mills and establishment of new mills. In this sequence, the this is the most conducive time for LNMVNN>N0@[NV0NGVY8U[=UGVRK
my wife name is Viddyotma as per government has made all the activities capacities of about two dozen mills have been increased. State-of-the-art mills have UP to achieve the target of one tril- PLGV 8 ² HXGNLT M LM HFK
addhar card for all future purpose outside the mandi campus free from any been set up in Pipraich town of Gorakhpur, Mundera town of Basti and Ramala lion dollar economy as visualised LIMRU=G I`UK GV YN \ \KGVW MNVGXV
, Subhas Chandra s/o Late licence and the mandi tax has been town of Baghpat. It is noteworthy that the opening of new mills and modernisa- by Chief Minister Yogi Adityanath. O(F8NK GN =$ NMNVJM MNI N
Ramenshwar A - 393 Awas Vikas waived, paving the way for the farmers to tion of old mills has been a historic step taken in the interest of farmers as 29 mills "This year alone bankers have IXIRQN+NN[ >NT\XVGKIUI)N
Hanspuram Naubasta Kanpur. sell their produce to anyone and any- were closed from 2007 to 2017 during the BSP and SP regimes. financed over seven lakh new GNVFWV@IXIRQN³L HZN0@[NV0NGVF6G D
agriculture items and waived mandi tax Q Centres of excellence in agriculture universities for research in the field. specialised institutions that could >NNUV HVD F6G
D GNXNH LDWNFX6 NX\F6G D @
from these products. Q In Uttar Pradesh, 8,496 cooperative societies through their cooperative dis handhold them such as BSE, >NNUNOD @YNE=4OOK
I, Usha Yadav W/O Bharat Besides, the government is setting up tribution centres are providing fertilisers and certified seeds. NSE, QCI, Institute of Packaging GNV 0 PUNB0018100 YNM9KWK
Singh R/O Flat No.102, centres of excellence in agriculture uni- Q Despite adverse situations due to COVID-19 pandemic in the Rabi market and the likes." He urged the O#XE=49KGV HN HOV IXIRQNGK
Rohinishreedham Aptt 127/7, versities to promote and encourage agri- in year 2020-21, the government set up 5,896 purchase centres which pur industries to utilise the govern- YDIUHYL\NV0IUI)NOV GIQXLZR= UG
U-Block , Nirala Nagar , Kanpur researches and ensure that these reach the chased 35.76 lakh metric tons of wheat from 6.63 lakh farmers and paid ment schemes for the overall WHNGKWN V[KU)NNF6G D HVD WHNIG VWNXV
Nagar - 208014 have changed
my name to Usha Devi Yadav
fields.
In the agriculture development sec-
Rs 6,885.16 crore for their produce.
Q The government has set a new record for the highest ever payment to
development of the state. "Our
industry associations such as CII,
GNON^ )NN NV7 Z9KYNMOD@>NNUV
GN XNH IX[=UGUN= F6G D YINGNMK `NMN
GN N=\ YYIN NNOKYYI+N 8UN
for all future purposes . tor, a new agriculture college is being set sugarcane farmers, including the dues of the previous governments. FICCI, must make their members J/UN^NIMURIXIRQNQNUN`NMN³IUJ/UN^NIMU WNVX @W W\G\IIR+NN[@
up in Gonda while the existing agricul- aware of the efforts being made by LV EXI/\LGK/G680³IU@E=H0KGV I\ X[MIIX[H@\ \>NX
OZSXN ture colleges at Lakhimpur Kheri and 2020-21, under Kharif Campaign 2020, paid Rs 6,885.16 crore for their produce. F6G D [NM9KGK/G60GNLK@WNMKGUN=F6G D YNUGN =#YNLZIU=JVUT
the development of agriculture research, 12.90 lakh metric tons, the cooperative get of 50 lakh metric ton, the government GV ON)N E\V'²NIXG\K ON4 R L%XK
H6DXV YLXV LT GN XNH Q] 20 new agriculture science centres have societies distributed 18.38 lakh metric tons purchased a record 56.57 lakh tons of YL\NV0 GK WN V[K@ Y8 )NN IG I/)NIU HVD
YXT+NRK %VGVQNMNVD OV HNVJMF8Q
NT ' \N Roodra Shukla OV been sanctioned out of which 15 have of fertilisers paddy. IXIRQNQNUN `NMN ³/UTU IXIRQN GNV /RU IXIRQN IQ ## GNV
FQ\GM Q]L]UNL NT'\NRudra started functioning. According to an official spokesman, In the Kharif marketing year 2020-21, IXM/UOH!NWN V[N$ON)NJKIXIRQNGV YLMN¬FWVUGYNNVJ/UN^NMK
Pratap Shukla GM I\ N J6$
In order to provide loans and invest- the Rabi marketing year 2020-21 had to it was ensured that the purchase centres +NN[ HVD UGXKGK IF0 L6X GN0=@ `NMNYNHDI UGKWNUKJ6@WNVPOK
ment in agriculture, the cooperative sec- face a lot of adversities due to the functioned till the time any farmer want- E8GH96'OIM9X=@WKO9KLDWKGMNGK IQXON DGN\FWVPLI/)NU
NV [ V 8 Q] GT H NM NT ' \ DS- tor plays an important role. In the state, COVID-19 pandemic. Still, the govern- ed to bring wheat or paddy to the pur- /R D³HNINU1N N³IUDRUGXKGKYXT+NR
1103/1104 OV 0K@ \0K 8,496 cooperative societies under their ment set up 5,896 purchase centres which chase centres. Till now, a record 65.5 lakh E5 NIQ@OD\;XGMXNYIXRN = J6$NMNVJM
IXIRQNQNUNYNVD GV OH^N >NNV\K
GN\NVXK@GNXLTMMNV0@\>NX cooperative distribution centres are pro- purchased 35.76 lakh metric tons of metric tons of paddy has been pur- MNI N#IXIRQN NTNNV\KWN V[K$ ##GNVOH FWV
+NN[ HVD QMVD RRNIN7 GIX HR NUV=
%LJDFKLHYHPHQWVRIACB HVD IXIRQNY[\VGN =IQROLMIXNN=IMUOH pipe line 360 mtr at Ram Nagar
Q Over 6 lakh infected cases reported of which around Q Jewar airport to be country's biggest airport. The first LM>NNV\KWN V[K$IXIRQNYNVD GNVIFXNGNVE=
NL)NK Mohammad Meraj Malin Basti, Aishbagh NMNVJM
8,000 died. phase will end in 2024. GNMN FUN V IXIRQN#IXIRQNYNVD GNV
S/o kallu carpenter IXRNOK Q Over 27 lakh migrant workers were given employment Q New airports built to increase connectivity in small Y/RKGNM#IR+NNIWU GMXV GN YINGNM MNI NIXIRQNHZ
;D2:=>F k5A830H k
;D2:=>F k5A830H kF
:ccZXReZ`_UVae
elections, adequate police reports about five persons,
1iecX XYcgYVUd_WUdXUb
arrangements should be including four from a family,
o ensure free and fair pan- chalked out and route charts dying after inhaling poisonous
T chayat polls in Uttar should be also prepared to gas inside an open septic tank
W`f_UYR_XZ_X
Pradesh, the State Election maintain law and order during in Fatehabad locality of Agra.
?=BQ ;D2:=>F the police said. The police 17>9?DA802C>A Commissioner on Thursday the elections process, he said. The incident took place last
want to quiz Chandan about 022DB43>51D;;H8=6 directed all the district magis- He said the district magis- Tuesday evening as a 12 feet
orking on the case relat- the weapon used for the 38A42C>AB>= trates and district police chiefs trates and district police chiefs deep sewage water tank was
?=BQ ;D2:=>F Sanjay consumed some poiso-
nous substance, the DCP said
W ed to BJP MP Kaushal
Kishore’s son Ayush, police
alleged attack on Ayush.
On the other hand,
A Bhojpuri film director
lodged a case against an actor,
to make on the spot inspection
of polling centres and take
would be responsible for free
and fair elections and if they
dug three days ago and left
uncovered. It was filled with
55-year-old section officer the forensic test would clear are mulling to bring him and Ankita alleged that the police Satrughna Kumar Yadav aka necessary action so that all the failed to deliver their duties four feet deep sewage.
A of Irrigation department
was found hanging at his offi-
the doubts, if any.
On the other hand, the
his wife face to face. Besides,
businessman Chandan, whose
did not initiate any legal
action on her complaint as
Khesari Lal Yadav and his aides,
for allegedly bullying him and
preparations of the elections
were completed in time.
with full honesty, action would
be taken accordingly.
The NHRC on Thursday
issued notices to chief secretary
cial residence in Mahanagar police came to know that name has figured in the con- they were under pressure his son, denting their image, Instructions have been also Kumar further said that all and the director general of
late on Thursday evening. Shiv Sanjay had called the woman troversy, was also served a because of Ayush being the disturbing them during a shoot given to resolve all the disputes the sensitive and hyper sensi- police of Uttar Pradesh and
Mohan Singh was all alone in around 11:57 pm on Tuesday. notice but he did not appear. son of a BJP MP. and during their stay at a club within 24 hours and to apprise tive polling centres should also sought a detailed report in the
his flat in Secretariat Colony “We are finding out where he The issue related to the The sources said that the on Kursi road in Gudamba. The the State Election Commission be identified so that action matter within four weeks,
was found hanging by his his was when he made the call and alleged attack on Ayush in the police have also taken revenge complainant, identified as of the action taken. The State could be taken for proper including measures being
wife after she returned home how long he remained there,” night on March 2 was mired and conspiracy theory angles Rajkumar R Pandey of Election Commissioner also deployment of force and other adopted by the state govern-
from somewhere. He was sources said. in claims and counter-claims. into consideration. Mumbai, said he has worked in warned the officials of stern measures to ensure peaceful ment to deal with such tragic
taken to a hospital where he They said it was suspect- “Both Ayush and his wife Ayush had suffered bullet the Bhojpuri film industry for action if any untoward incident election. He said that polling incidents.
was declared brought dead. ed that Sanjay consumed some Ankita have made public sev- injuries in the night on March over 30 years and has a wide took place. centres should be made keep- The NHRC observed that
Police said no suicide note was poisonous substance and died eral videos with different 2 when he was out of his range of fans and supporters. Interacting with the district ing in mind the board exami- five lives were lost due to the
recovered. as a result. “It is possible that claims and allegations on house. He had a love marriage He said his son Pradeep Pandey magistrates and district police nations so that no polling cen- apparent negligence of the
In another case, the shop- he took the step out of frustra- each other. Also, Ayush could with Ankita and was attacked aka Chintu has been child actor chiefs of all the districts of the tre was close to the examina- owner of the house as well as
ping mall employee, Sanjay, tion, or he was forced-fed not explain or provide evi- allegedly by Ankita’s brother in Bhojpuri films for last 12 state through video confer- tion centres. He also remind- the authorities responsible to
had talked for several minutes poison or forced to consume dence to the police for exon- Adarsh, who was arrested years and achieved stardom. encing on Thursday, State ed the officials to review the monitor such work in their area
to the woman, with whom he it himself,” the sources said. eration even tough he was later. Earlier, the police had Pandey alleged that Election Commissioner Manoj preventive action taken by of jurisdiction and it was nec-
was said to be in love, before Sanjay was found lying summoned to the police sta- issued a notice under Section Khesari Lal and his aides, iden- Kumar said asked them to visit junior officers for free and fair essary to fix the responsibility
his death under mysterious dead outside his house on tion twice,” sources said. 41 of CrPC to Ayush, sum- tified as Arjun Yadav Arya of all the polling centres under polls. and take action against the
circumstances in Chinhat. Wednesday. He was missing They said the police are moning him to the police Gopalganj in Bihar, Akhilesh their jurisdiction and take nec- Additional Election guilty so that such incidents of
The police got the autop- since Tuesday night. His fam- now planning to summon station to record his state- Pandey aka Akhilesh Kashyap essary action so that any type Commissioner Ved Prakash gross negligence causing death
sy conducted on Thursday. ily had alleged that the fami- both Ayush and Ankita to ment. of Buxar and Mahboob Khan of dispute or shortcoming Sharma asked the district mag- were not repeated.
DCP (East) Sanjeev Suman ly of a woman, who is a resi- quiz them together. The On Tuesday, Ayush had were jealous of him and his regarding elections was istrates to take strict action and According to the media
said the cause of death could dent of the same locality, got police said teams have been claimed that he was shot at by son. “They call and bully us resolved within 24 hours. He check illegal sale or supply of reports, carried on March 17,
not be ascertained and doctors Sanjay killed. The police were searching for Chandan as he Adarsh as he had a fight with using abusive language. They also asked them to update the liquor to influence the polls. He the string of deaths began
advised that the viscera be pre- puzzled by the blood stains on did not turn up at the police his sister Ankita. He said he uploaded their albums and SEC of the action taken in the also directed them to take when a 10-year-old boy acci-
served. He explained that the terrace of the multi-storey station despite being sum- came out of the house after a made the phone number of my matter. Kumar asked the dis- round of booths in the rural dentally fell into the open sep-
Sanjay had no external building where Sanjay lived moned. “He initially pretend- fight with Ankita and was son public. Their supporters trict officials to visit the arms areas also and to ensure that all tic tank. His two elder broth-
injuries. “The forensic test of with his family. The police also ed that he was busy and later chased by Adarsh and shot at and fans also bully and troll us shop and check the register and the nomination process was ers, aged 16 and 17 years,
the viscera will ascertain the pressed a sniffer into service switched off his phone. His twice. He also alleged that on different social media plat- if any irregularity was deduct- recorded to take necessary respectively, jumped into the
cause of death,” he said. but could not get any clinch- location is not known to us Chandan had given the pistol forms,” he said, requesting ed, take action accordingly. action in case of violation of gaping hole after listening to
Categorically denying that ing evidence. and we are searching for him,” to Adarsh. police help. To ensure free and fair SEC guidelines. the wails of their sibling.
"!! jcTV]VScReZ`_d
`W:_UZR_3`eR_ZTR]
D`TZVejSVXZ_de`URj
1[cXQi _dXUbcfYcYd1i_TXiQ 110Dc^bcPac\PbcTa´b 4:EJ3C:67D
R^dabTX]5X[\BcdSXTb ³=>=>C824>=68A;B´3A4BB2>348BBD431H;D´
V_b]eXebQd_V´BQ]CUdeµ P]S?A0SeTacXbX]V ing slapping
Lucknow University has denied issuing any notice regard-
Lucknow (PNS): The centenial fine on girls wearing short dresses at Tilak Hostel.
celebrations for the formation Lucknow (PNS): The Mass Spokesperson Durgesh Srivastava said no notice has been issued
of Indian Botanical Society Communication and by Lucknow University. The statement was issued after a ‘notice’
(IBS) will kick off at National ?=BQ ;D2:=>F Journalism department of allegedly by the provost of Tilak Hostel went viral on social media
Botanical Research Institute to the heavy crowd. The actors BBAU has proposed a Master’s groups. It was hand-written and without a letterhead. It was men-
(NBRI) on Friday. Director SK ollywood actor Akshay reached CCS Airport in course in Film Studies and tioned that no girl should roam outside their respective blocks
Barik said the Society is a pro-
fessional body of all botanists
B Kumar along with actress-
es Jacqueline Fernandez and
Lucknow on Thursday morn-
ing and took a road route to
Public Relations & Advertising
and a PG diploma course in
in shorts or dresses above knee length. It was also written that
coming outside in spaghetti or vulgar tops was not allowed and
and was formed in 1920 by Nushrat Bharucha visited Ram Ayodhya where they per- Science Communication. This that the violators would have to shell out a fine of Rs 100.
Prof Birbal Sahni and other sci- Janmabhoomi on Thursday formed the muhurat puja in was announced by the head of
entists. He said that along with for the mahurat of their front of Ram Lalla in the Ram the department at an alumni 0AC20
;D2:=>F k5A830H k=44A=4FBB4AE824Q0;;070103 rule should also apply in
mosques.
n the issue of writing a letter Giri further said that the
I of disturbance in sleep of
Vice-Chancellor of Allahabad
High Court has ordered not to
make noise through loudspeak-
University at dawn due to the ers at religious places, officers
?8>=44A=4FBB4AE824QE0A0=0B8 ities and misuse of central and Yogi Adityanath to remove encroachment from public blaring sound of ‘azaan’ in concerned should get it fol-
state finance commissions as illegal encroachments from the property and pond in village mosque,. Hindu religious lead- lowed. Swami Ramathirtha Das
IRs will be lodged against per their guidelines. public properties located in Nawapura (Sathwan). During ers have stood up in support of said that it is not proper to take
F three including two village
development officers (VDOs)
In this direction, he has
instructed the concerned assis-
rural areas such as ponds,
roads, play grounds, waste
the anti-encroachment drive
several semi-constructed pucca
Sangeeta Srivastava. Mahant
Narendra Giri, president of
away one's peace in the name
of religion.
posted in Chiraigaon and tant development officers land, panchayat and school houses were demolished and Akhil Bharatiya Akhara The court has set the stan-
Harahua blocks and a Gram (Panchayat) to file FIRs against buildings and land property the pond was also made free Parishad (ABAP), the largest dard for voice with the mike,
Panchayat Adhikari (GPA), them. and ensure the work of making from illegal possession. organisation of saints, has jus- which is not being followed.
also of Harahua block in con- He also informed that sim- Gharuni and cent per cent Revenue Inspector (Sarnath) tified the Vice-Chancellor's Paramhans Prabhakar Ji
nection with their involvement ilarly one GPA of Chiraigaon inheritance, the SDM (Sadar) Rajeev Kumar informed that a complaint. Maharaj said that it is inappro-
in irregularities in purchasing block has also been suspended Pramod Kumar Pandey held a team has been formed under He said that the time for priate to make noise in the
tables, benches etc and for his alleged irregularities in ‘chaupal’ at village Nawapura the leadership of SDM to offering Namaz in mosques is morning in the name of azaan
installing swings and high the functions of the Gram on Wednesday where the offi- remove the illegal encroach- set. In such a situation, what is from the mosque. If there is a
mask lights in primary schools Panchayat and disobeying the cers heard the grievances of the ments from public property the need for them to call some- tradition of offering azaan, it
under the village funds received instructions of the higher offi- villagers. and the campaign would con- one through a loudspeaker? should be done without a loud-
from central and state finance cials. The SDM has instructed tinue continuously till the The one who offers Namaz will speaker.
commissions. Meanwhile, in connection the officers concerned to dis- entire area is made free from come automatically at the RcTY#%
?8>=44A=4FBB4AE824Q0;;070103 encroached the government be initiated immediately. If the fire in early morning hours in
land. DM faces any difficulty, he Koraon injuring a morning
istrict Magistrate This order was passed by a should send his report to the walker. The police came into
D Kushinagar has been
instructed by the Allahabad
division bench consisting of
Justice Sanjay Yadav and Justice
court, which will issue fresh
directions after going through
action and arrested the boy. He
is being interrogated. An old
?8>=44A=4FBB4AE824QE0A0=0B8 present songs and dances. He High Court to free Ajay Bhanot on a Public the report. enmity is stated to be the cause
said that for the Gavna of Government land from the Interest Litigation filed by one The court has directed SP behind this incident.
he 357th Rangbhari Baba, 151 kilograms of abhir clutches of encroachers. If nec- Manoj Kumar Jaiswal. Kushinagar to make available The injured Sudhanshu
T Ekadeshi of Kashi
Vishwanath temple will be held
made of roses would be
brought from Mathura. He
essary the Revenue depart-
ment officials should seek help
The petitioner had request-
ed the court to direct the offi-
adequate force if required by
the officers of the Revenue
Keshri, 20 has been rushed to
SRN Hospital. He has sus-
on March 24 and on the same said that in the history of 357 of the police to see the work cials for removing encroach- department for removing tained splinter injuries in his
day, Shivanjali Sangeet years it would be the second done, the court ordered. ment from the Government encroachment. head, leg near knee and on his
Samaroh will also be organised. time when the participants The court said that the land in Dudhahi village. If anybody is aggrieved by back. The shooter Aishvarya
Giving this information while would cover a long distance to District Magistrate should Persons have raised buildings the orders of the District Srivastava has been arrested
talking to the reporters here on reach Kashi Vishwanath tem- enquire into the reports of after illegally occupying Magistrate, he should move the with his pistol. According to
Thursday, former Mahant of ple. encroachment of Government Government land, the peti- appropriate court for remedy, reports he is a minor.
Kashi Vishwanath temple Dr It may be mentioned that land in Dudhahi village tioner alleged. and the district administration This on road firing came as
Kulpati Tiwari said that prior under the ongoing Kashi Padrauna, Mahurahi The court accepted the should give one week time for a shock for the local residents
to Rangbhari Ekadeshi, the Vishwanath Corridor project, Tamkhuiraj Tehsil, and initiate PIL and directed the DM to the same before initiating and the morning walkers who
traditional rituals of ‘Gavna’ of ex-Mahant’s house located near immediate action to remove look into the encroachment action against encroachment. were walking near Ledhiyari
Baba (Lord Shiva) will be start- Kashi Vishwanath temple was encroachment. Fine should issue. If the allegations are MINOR WHO OPENED filling station in Koraon on
ed from March 21 at his shifted to Tedineem area but also be levied on those who had found to be true, action should FIRE HELD: A minor opened Thursday morning.
Tedineem located residence. now the procession would pass
According to Dr Tiwari, as through Sakshi Vinayak,
PRUHGLHDIWHUFRQVXPLQJVSXULRXVOLTXRU
per the tradition of Kashi, Kortwalpura, Dundhiraj
Mahadev (Lord Shiva) gets Ganesh and Annapurna
married with Mahamaya Mandir to reach Kashi
(Goddess Parvati) on the aus- 4g =44A=4FBB4AE824QE0A0=0B8 Ramjanam, Janvadi Naujawan lage, said that her father used trans-Ganga area of Handia. started from Prayagraj Sangam pm. People were relieved by the
Sabha’s Anil Kumar Singh, to consume alcohol daily. The fire broke out at the resi- (Prayagghat). Permission was running of these trains. Station
n protest against the privati- Chaudhar y Rajendra of Yesterday i.e. on Wednesday, dence of Lallu Nishad and not given by Railway Board to Superintendent of Prayagraj
Iofficers
sation, the employees and
of LIC staged a demon-
Samyukta Kisan Morcha, LIC
Class Federation’s Rajesh
his health deteriorated and
was taken to Saidabad CHC.
spread in nearby fields where
a ripe Rabi crop is standing.
extend the rounds of the five
trains to run till March 15. The
Sangam, AM Pathak, said that
five trains have been stopped
stration at their Divisional Upadhyay, JN Sarin, Shipra During his treatment there, he The local residents 04233 special train going to due to non-release of the new
Office, Bhelupur here on Nag, Ranjit Pandey, NFIFWI died on Thursday morning. switched on their pumps to Prayagraj Sangam-Mankapur schedule. Four trains were can-
Thursday. They also held a general secretary Ashwani According to Nisha, she had douse the fire, but they failed departed from Prayagraj celled on February 17 as well.
meeting during their lunch Singh, LIC Employees’ got liquor in the farm. At the to tame the flames. The police Sangam at 6:10 pm and reached Compliance will be made on
break. Addressing the meeting, Federation president Suresh same time, Rajbali Bharti, the and fire brigade were informed, Mankapur at 12:50 pm via arrival of a new order.
the speakers strongly flayed the Srivastava and VDIEA gener-
Central Government for its al secretary Binod Srivastava
&' !$]R\YdefUV_edcVXZdeVc
faulty economic policies and expressed their views.
moves of privatisation. The The meeting was presided
protest was also joined by sev- over by VDIEA president
eral senior trade union leaders Narayan Chatterjee, while the
and others. vote of thanks was proposed by
W`c9D :_eVcViR^d
The speakers demanded Sanjeev Singh. A large number
immediate implementation of of LIC employees were also
pending salary revision of LIC ;82T\_[^hTTb_a^cTbcX]VPc1WT[d_da3XeXbX^]P[>UUXRTX] present and among them were
employees. EPaP]PbX^]CWdabSPh?X^]TTa Jitendra Kumar, Rakesh
They opposed the govern- Gujarati, DC Singh, Aarti
ment moves of listing LIC in employees. General secretary of CITU vice- president Pramod Srivastava, Sagar, Sumant ALLAHABAD (PNS): In spite School and 25,86,339 in released by the United Nations, Officer (Prayagraj) Dr
share markets and raising the Central Staff Coordination Verma, Jagriti Rahi of Sarva Kumar, Sujeet Kumar, Rita, of the impact of COVID-19 on Intermediate) last year. 118 countries have less than 56 Prabhakar Rai and District
FDI limit of insurance sector Committee Jyoti Shankar Seva Sangh, Kisan Sabha’s Suchandra, Krishna Pandey schools and studies, 56,03,813 In 1947, the examinee lakh population. Surveillance Officer (DSO) Dr
from 49 to 74 per cent. They Dubey, divisional secretary of Shyamlal Singh, Mobin Ahmed etc. In the centenary year of students have registered this count swelled to 48,519 for COVID-19: Out of the Rahul Singh analysed the
said that they had extended Postal Employees’ Union, of Bunkar Dastkar Morcha, Dandi March, the farmers’ year to appear in the High which 224 examination centres total 11.35 lakh samples collect- COVID-19 statistics and found
their full support to recent Subhash Sah, Samajwadi Jan CITU’s state secretar y movement was also supported School and Intermediate exam- were made. The count further ed in Sangam city, roughly that the percentage of people
strike of trade unions and bank Parishad’s Aflatoon Desai, Devashish, Swaraj Abhiyan’s by the VDIEA members. inations of UP Board. This year increased to 1,72,246 in 1952. 2.58 per cent of the samples who tested positive for
is also the board’s centenary ‘For 2021 exams, a total of tested positive for the novel COVID-19 infection was mere-
year. The total number of stu- 56,03,813 students, including coronavirus infection since the ly 2.58 per cent during the
.DODVK6KREKD=44A=4FBB4AE824QE0A0=0B8 Finland and Ireland, each hav- Divya Kant Shukla. The num- fortnight this month. This is a for RTPCR test and 1,436 for
ing less than 56 lakh citizens. ber is still high even though UP positive trend, given the recent Truenet Covid test between
Kalash Shobha Yatra was The UP Board, set up in Board had adopted strict anti- spike in COVID-19 cases in March 1. To date, 74 of them
A taken out from
Pichashmochan Brahma Dham
1921 at Allahabad by an act of
the United Provinces
copying measures following
which the count of examinees
different parts of the country in
March. After analysing the
tested positive for COVID-19
infection. This means that the
in the presence of former UP Legislative Council, had con- registering for exams had fall- records, officials of the Health infection rate after March 1 to
Minister Ajay Rai here on ducted its first examination in en in the past few years. In department on Wednesday date has been 0.15 per cent.
Thursday. The procession 1923. In its 100 years of jour- 2018, as many as 66,37,018 stu- claimed to have collected a total Dr Singh also informed
began after offering tradition- ney, the number of students dents had enrolled for board of 11,35,335 samples for testing that the number of people who
al prayer and rituals. It also appearing in its High School exams. As students increased, and 29,394 of them tested pos- tested positive for the COVID-
marked the beginning of week- and Intermediate exams has the UP Board opened region- itive for COVID-19 infection in 19 infection in the city was
long celebration which would increased 976 times, earning it al offices in Meerut (1973), the past one year. reported less than 10 patients
continue till March 25 in which the distinction of being one of Varanasi (1978), Bareilly Statistics also revealed that in the last 20 days. Moreover,
Srimad Bhagwat Katha will be the largest examination con- (1981), Prayagraj (1987) and the death percentage among Sangam city has not reported
organised. Hundreds of women ducting bodies of the world. Gorakhpur (2017), which are COVID-19 positive patients any death due to COVID-19
carrying Kalash (urns) took As per records, 5,744 stu- running under regional secre- in Sangam city was 1.39 per infection in the past 35 days.
part in the procession. They dents had registered for the taries. ‘The increase in the cent. Moreover, around 99.90 Expressing satisfaction
were also welcomed at some board’s first examinations con- number of examinees has per cent of patients had recov- over the constant fall in infec-
places. Munna Lal Pandey and ducted at 179 centres in 1923. increased the workload many ered in the home isolation tion levels in the city in the past
Pradeep Pandey were the Then 5,655 students were in times. Five regional offices method. Data also claimed fortnight, Dr Singh has
covenors. High School and 89 in were set up over the years new that 21,756 patients have recov- appealed to denizens of
Ajay Rai said that the :P[PbWBW^QWPHPcaPQTX]VcPZT]^dcX]EPaP]PbX^]CWdabSPh?X^]TTa Intermediate. technologies were embraced ered in home isolation, while Sangam city to maintain social
Kalash Yatra was performed for In a span of 100 years, the besides adopting anti-copying 7,189 others were discharged distancing and use of masks
the welfare of the people. dent Raghavendra Choubey, Chanchal Sharma, Rohit Pathak, Hanumant Sharan count of examinees swelled measures for holding fair and recovered from Covid hos- and sanitisers. He also appealed
Among those who also took Om Prakash Ojha, Manish Dubey, Vineet Choubey, Choubey, Manoj Yadav, Azad from 5,744 in 1923 to 56,07,118 examinations,’ said officials. pitals. A team of health officials to the citizens to go for wash-
part were city Congress presi- Morolia, Anand Pandey, Kishan Yadav, Amit and Raju. (including 30,24,480 in High As per the 2019 figures including the Chief Medical ing of hands frequently.
;D2:=>Fk5A830H kE4=5>ADB diers’ graves so that people enjoy it. Fake news, just like
RSSRQHQWVWRFXWDGHDO$VWKH1,$LQYHVWLJDWLRQXQIROGVWKHVLWXDWLRQZLOOEHFRPH
faking emotions — clapping for
a performance you hated or
habit. If you want to live in
the brave new world of fake, A867C=>FA867C don’t feel paranoid about
national security. Isn’t that
a fake orgasm, is loaded with
good intentions. Both offer a
PXUNLHUE\WKHGD\/HW·VVHHZKDWKDSSHQVLQ0DKDUDVKWUDDQGKRZPDQ\´GLUW\ smiling at the stranger who give up your habit of ques- 74A45>A>DA fake better than the real? feel-good factor to the second
ILVKµDUHQHWWHGE\WKHLQYHVWLJDWRUV stepped on your toes is so much
part of you and me. We are all
tioning everything. Being
rational is no virtue any- >F=6>>3 In any case, we can do
nothing more than delete
party. A false sense of satis-
faction, but satisfying
walking, talking fakes. Then more. These are old-school =>1>3HF>D;3 some Chinese apps on our nonetheless.
%D1:=>F Chinese mobile phones. So
why the fuss? Rest assured, we
Fake, then, is the new
real. The new textbooks with
space in your national life. It good. It does no good to you. F70C8BA40;0=3 have a new reality being new insights on history and
helps you feel proud of the
nation you belong to. Now that
Haven’t you read how fake
news about the death of an ele-
F70C8B=³C 50:4 woven for us right now, right
here, for our own good.
polity, untold theories of the
greatness of a nation and the
it is done with such élan that one phant, Ashwathama, helped 8B148=6083431H Nobody would be able to stories of heroes hitherto
should feel rather blessed. Fake
news is a work of art and has a
the Pandavas get rid of
Dronacharya and paved the
C427=>;>6HC70C know what is real and what
isn’t. Fake is being aided by
unknown would help create
an alternative reality. It is so
pre-defined purpose. It makes way for their victory in the 74;?B2A40C40= technology. Photoshopped realistic! So, be prepared
you feel happy and content. Mahabharata? We all know 0;C4A=0C8E4 images, doctored videos and because the floodgates of
Now that faking has how Krishna pulled off a fake edited audios help create an fake are wide open.
emerged as a fine art, we have all sunset to save Arjuna from A40;8CH8=C78B alternative reality in this ago- Meanwhile, just ponder what
the more reasons to embrace it self-immolation and helped 06>=8B8=6;H nisingly real or surreal world. the great men had said about
with open arms. For those who
might have moral compunctions
him exact revenge on Jaidrath.
Does one need more stories to A40;F>A;3 What more could you ask for?
Unlike real news, fake
Facebook and WhatsApp!
(The writer is a columnist
in doing so, I have this to say: validate the glory of the “fake”? news is fast and smart. It con- and documentary film-maker.
Don’t you believe in the concept Of course, some spoilers vinces, motivates and propels The views expressed are
of “Maya”; this world is anything earn their bread and butter you to act. And what does the personal.)
F^\T][PQ^daTab_d[[PRPac[PST]fXcWfPbcTQdX[SX]V\PcTaXP[X]0W\TSPQPS ?C8
'' ( ')'
'* %')( 6281'%,7(
D85?D7?F5B>=5>D
Cd_`S_\_^YQ\`bQSdYSUc
8UTT[cWPccWT2
;D2:=>Fk5A830H k5C74
community stakeholders. These efforts, howev- 6A0BBA>>CB
DQGDGGUHVVVKDUHGFKDOOHQJHVLQFOXGLQJLQF\EHUVSDFHFULWLFDOWHFK er, are isolated in nature, highlighting the need
QRORJLHVFRXQWHUWHUURULVPTXDOLW\LQIUDVWUXFWXUHLQYHVWPHQWKXPDQ 8=B818;8C84B of convictions. ment at the State or national level. prevention of human trafficking
care and support services to the survivors, only 0;>=6F8C7 Another critical gap in the These efforts need to be in collab- with external audit and evalua-
42 per cent focused on building, strengthening, 34B86=8=6 ecosystem pivots around the low oration with organisations work- tions, can be helpful.
and actively addressing gaps in the existing AHT 2>=C4GCD0;8B43 capacity of rehabilitation homes — ing across different parts of the Moreover, creating networks of
systems. Thus, there is a strong need for a bal- 8=C4AE4=C8>=B this is magnified when juxtaposed survivor life cycle and geographies. organisations working in different
GDUGVDQGILQDOO\DFOLPDWHDFWLRQZRUNJURXS,WLVHQFRXUDJLQJWRQRWH anced approach between these two functions of 5>AC74 against the increasing need for On-ground organisations are often States and networks that are fun-
WKDWGHVSLWHDOPRVWDOORIWKHVHVROXWLRQVIHDWXULQJSURPLQHQWO\LQELODW AHT programmes, with the disconnect often ?A4E4=C8>=>5 rehabilitation both in transit and burdened with various other chal- der-led across areas of intervention
leading to structural and systematic gaps and 7D=B
:KLOHPXFKKDVEHHQVDLGDERXWFOLPDWHDQGYDFFLQHFRRSHUD tunities, holistic reintegration mechanisms and
20=1474;?5D; Solving the gaps in the AHT consider all survivor needs. ening legal action and processes,
WLRQWKHLVVXHRIMRLQWGHYHORSPHQWRIQHZLQWHUQDWLRQDOVWDQGDUGVIRU social stigma can lead to re-trafficking of sur- landscape: Keeping in mind the Collaborative efforts and mea- funder-led approaches for financial
HPHUJLQJWHFKQRORJLHVQHHGVWREHVWUHVVHG$Q\QHZWHFKQRORJ\QHHGV vivors. Even though there is increasing collab- structural and systematic nature of sures need to be taken at the sys- aid or capacity building for NGOs
WR IROORZ FHUWDLQ JOREDOO\ DFFHSWHG LQWHURSHUDEOH SURWRFROV )RU oration between organisations across various the gaps in the ecosystem, there is temic, programmatic and delivery can lead to immense eventual
intervention types in the ecosystem, most a primary need for strengthening level to ensure a comprehensive value for survivors, be it through
LQVWDQFHDEXQFKRISOXJVIRUDQ\HOHFWURQLFHTXLSPHQWKDVWRDGKHUH stakeholders continue to operate in silos with lit- the capacity and engagement of response to human trafficking. rehabilitation, medical care, or
WRDFHUWDLQLQWHUQDWLRQDOVWDQGDUGWREHDEOHWREHVROGJOREDOO\,IQDWLRQV tle coordination across State and national bor- implementing organisations and Across stakeholders, the creation the provision of mental healthcare.
VWDUWGHYHORSLQJJRRGVDFFRUGLQJWRWKHLURZQFRXQWU\VSHFLILFVWDQ ders. Due to the lack of collaboration, implemen- other stakeholders in the overall of common data repositories and Fundamentally though, an
GDUGVLWPD\OHDGWRIRUFHGH[FOXVLRQRIJOREDOSURGXFWVLQGRPHVWLF tation organisations also report having a high AHT ecosystem. It is critical to investments in centralised tracking increased focus on survivor and
PDUNHWVDQGDVHWEDFNIRUVHDPOHVVJOREDOVXSSO\FKDLQV7KHLVVXH dependence on funders. start working towards collabora- systems is an important step that community-led and community-
EHFRPHVIDUPRUHFRPSOH[ZLWKQHZWHFKQRORJLHVZLWKHYHU\RQHWU\ The study suggested that other critical gaps tion and coordination, given the could be a means to prevent re- centric solutions is imperative.
LQJWRGHFLSKHUWKHSRWHQWLDOFKDOOHQJHVDQGULVNV,Q,QGLD·VFDVHD have crept in across the ecosystem due to a lack expanding nexus of traffickers, trafficking. The Indian AHT ecosystem needs
of tailored interventions at the initial stages of Dang and Reddy are especially within the context of This could be coupled with a to move beyond treating survivors
ZHDSRQLVHGWHFKQRORJ\DLGHGQHLJKERXUSXVKLQJWKHHQYHORSHRQDOO trafficking prevention, along with an absence of research consultants while emergencies like the COVID-19 means to incorporate feedback as victims and rather empower and
IURQWVFRXOGPHDQXQLSRODUVWDQGDUGVGRPLQDQFHZRUOGRUGHU7KLVLV robust tracking mechanisms leading to informa- Puri is research associate, pandemic. mechanisms, wherein survivors create survivor leadership models
UHGDOHUWIRUDOOIXWXUHFRDOLWLRQVDVWKHZRUOGKDVJRWDPSOHHYLGHQFH tion asymmetry across the ecosystem when it Sattva Consulting. These traffickers can range provide feedback to the imple- wherein the victims can grow
The views expressed
RIZKDWDVLQJOH6WDWHEDFNHGWHFKQRORJ\FRPSDQ\FDQGRWRGLVUXSW comes to the scope or scale of the problem. The are personal.
from opportunistic individuals to menting organisations on sup- within the ecosystem and influence
VRYHUHLJQV7KH4XDGQDWLRQVDUHDOOWHFKQRORJ\OHDGHUVDQGQHHGWR absence of standard procedures to guide rescue sophisticated criminal organisa- port received from Government it.
GHYHORSDFORVHUERQGLIQRWDVVLJQDZRUNLQJVHFUHWDULDWZLWKSHUPD
QHQWVWDIIWREHDEOHWRVKDSHXSWKHVWFHQWXU\GLJLWDOHFRQRP\QDU
UDWLYH(YHQWKRXJKWKH4XDGVWDWHPHQWGLGQRWPHQWLRQDMRLQWGHIHQFH 32,17&2817(532,17
ZRUNLQJJURXSLWPHQWLRQVFRPPLWPHQW´WRSURPRWLQJDIUHHRSHQ
UXOHVEDVHGRUGHUURRWHGLQLQWHUQDWLRQDOODZWRDGYDQFHVHFXULW\DQG C7419?F782770B0B8I401;4?A4B4=248= C78BBC0C4DC
SURVSHULW\DQGFRXQWHUWKUHDWVWRERWKLQWKH,QGR3DFLILFDQGEH\RQGµ
$OORIWKHVHSRLQWVDUHNH\WRGHILQLQJUHODWLRQVKLSVDPRQJWKHQDWLRQV
274=60=>>A0=30A0=AC7450E>DA8CF8;;14A4248E8=68=A0==8 C7434=80;>5C82:4CC>78AA>5³C74>A60=8B4A´ °:4A0;019?27845
IURP(XURSHDQGWKH8.FRXOGEHDJRRGPRYHJRLQJDKHDG A10;0B0=:0A :BDA4=3A0=
7KHZULWHULVDSROLF\DQDO\VW7KHYLHZVH[SUHVVHG
DUHSHUVRQDO
&XPXODWLYHHIIRUWVPXVWWRVDYHVSDUURZIURPH[WLQFWLRQ
([ORJOTMYGTJUZNKXV[HROIYVGIKYS[YZNG\KGTKTGHROTMKT\OXUTSKTZOTZNKLUXSULTKYZOTMVRGIKYZUNKRVZNKHOXJMKZGZUKNURJOTU[XIOZOKYGMGOT
he humble house spar- appeared from various cities reproduce faster but also put species as it mainly survives The house sparrow plays special initiative aimed
T row or Passer domesti-
cus is a bird most of us
grew up with. The chorus of
in just under a decade.
Each year March 20 is
observed as the World
more pressure on the available
food resources.
These conditions have dri-
close to human settlements
and largely feeds on grains.
The species is considered as a
a vital role in balancing the
ecological biodiversity of a city
where the flora and fauna sur-
towards resuscitating house
sparrows in the cities.
Buildings and other public
chirping that greeted one at Sparrow Day and rightly so, as ven sparrows to the fringes hardy survivor as it can adjust vive due to the complimenta- spaces must have an enabling
sunrise and sunset was as these birds deserve sincere and peri-urban locations and in most weather conditions, ry role played by each one of environment in the form of
good as clockwork, but slow- conservation efforts because unless supporting measures therefore, it is all the more them. The extinction of an nesting places to help the
ly and surely these little they have been displaced from are undertaken to protect the shocking that this little, strong entire species is bound to bird get a foothold in urban
delightful and hyperactive ;?D1 (%(, their genuine habitats due to bird, it might disappear from bird is now nowhere to be create an imbalance that can spaces.
birds have bid adieu to our anthropogenic intervention. these locations as well. seen. damage nature’s setting and NGOs can be roped in to
homes and cities. This has Modern technology-based As the sparrow becomes examples of this tragic occur- The fate of the species was eventually harm human sur- work with Resident Welfare
been an ongoing process since outdoor equipment coupled an increasingly rare sight, the rence. The treatment of crops sealed due to the acute short- vival, too, as we also are a part Associations (RWAs) to help
the 1990s. with rising pollution levels has bird’s extinction itself may with aldrin pesticide to protect age of nesting sites in modern of nature. build artificial nests that can
Designated as the State disturbed the ambient living not be far off. The avian against termites claimed a concrete buildings, disappear- Many not-for-profit insti- provide a secure place for the
bird of Delhi in 2012, the spar- conditions of these birds in species of carrier pigeons huge number of the Sarus ing kitchen gardens and the tutions are engaged in breath- birds to breed and keep their
row has been facing multiple our cities. which were in abundance at cranes in Rajasthan as these non-availability of a particu- ing life into the dying species newborns safe. House spar-
threats to its very existence The rapid rise of cell the beginning of the 19th birds fed on wheat. Post this lar larvae (Helicoverpa of house sparrows. These spir- rows are birds of short flight
but, curiously, the phone towers and the resul- century are nowhere to be blow, the crane population armigera), associated with the ited efforts of the non-govern- and, as such, cannot fly long
International Union for tant radiation emission from seen now. The same is the case could never recover and even- field bean. These adverse con- mental organisations (NGOs) distances to bring food to
Conservation of Nature these towers, coupled with with the white-backed vulture tually disappeared. The ring ditions, coupled with the ris- are a valiant fight to keep the nourish the newborns, so the
(IUCN) Red List has cate- noxious pollution levels have which used to be a common dove birds, too, fell for the ing heat island effect from spunky bird alive. However, RWAs can set up locations
gorised the bird as being of severely challenged the spar- sight in the 1980s but is not aldrin-laced crops and met the concretised urban settings, unless the Government inside residential colonies and
“Least Concern” which means row population of our cities. anywhere to be seen now. same fate. This indiscriminate meant that the bird could throws its weight behind the societies where provision of
that it is a species requiring These conditions have been In some cases, fascinating use of pesticide has obliterat- also not withstand exception- activities of these NGOs it nutritious bird feed can be
least conservation attention. The writer is an exacerbated by the burgeon- insectivorous bird species have ally high temperatures. This could be akin to fighting a los- done for the benefit of the
environmental journalist. ed some amazing avian
This is concerning consider- The views expressed ing population of other inva- succumbed to pesticide poi- species forever from our lives. ultimately drove the species to ing battle to save the species. sparrows. If these hardy little
ing that huge swathes of the are personal. sive bird species such as that soning. The drongo and bee- The house sparrow is city fringes where food avail- As a first step, the munic- birds are lost forever, it will be
sparrow population have dis- of pigeons which not only eater birds can be cited as considered to be a social avian ability was a major problem. ipal corporations must start a a great loss to mankind.
;D2:=>Fk5A830H kCdefUV_edSRT\Wc`^
Diversity. The winners were and 25 depart from air-conditioned (AC) third Lucknow at 07.10 hrs, Bareilly at
Vandana Yadav who bagged the Chandigarh at 23.20 hrs, from class, two of AC second class 11.02 hrs and Moradabad at
title of Queen of Hearts, India Ambala at 00.25 hrs, from and two of generator-cum- 12.50 hrs and reach New Delhi
Diva Rajlaxmi, Miss Yamunanagar at 01.12 hrs, luggage van will be attached in at 16.15 hrs. A total of 21 coach-
5fSRZ F26ecZa
Fashionista, Mustak Sharma. from Saharanpur at 02.20 hrs, this special train. es, including four of general sec-
The vote of thanks was from Moradabad at 05.33 hrs, NEW DELHI-BARAUNI ond class, seven of sleeper class,
proposed by Dr Pragya from Bareilly at 06.55 hrs, FESTIVAL SPL: The 04040 six of AC third class, two of AC
Srivastava. from Lucknow at 11.10 hrs, New Delhi-Barauni festival second class and two of gener-
Dr Rashmi Chaturvedi, Dr from Gonda at 13.25 hrs, from special train will on March 19, ator-cum-luggage van will be
Kalpana Srivastava and sever- Basti at 15.10 hrs and reach 23, 26 and 30 depart from New attached in this special train.
?8>=44A=4FBB4AE824Q:0=?DA al others were present.
P rof Devendra Jaiswal, the
official spokesperson of Dr
7=3 `bY^SY`Q\]UUdc@bUcYTU^d
Gaur Hari Singhania Institute FULPLQDOVKHOG &255(6321'(17Q -$/$81 said deliveries of 60 Covid
of Management and Research, patients were done and in 40
while addressing the media KANPUR (PNS): The resident Ram Nath Kovind cases both babies and their
on Thursday, said that the sec-
ond year batch of 2019-21,
Kalyanpur police arrested two
persons when they were plan-
P appreciated the efforts of prin-
cipal, Government Medical College
mothers recovered from the dis-
ease. In the remaining 20 cases
which had gone for an indus- ning to remove cash from the (GMC), Jalaun. Principal Dr babies were not infected but their
trial visit to Dubai and UAE, ATM of the Bank of Baroda Dwijendra Nath recently handed mothers had tested positive for
had returned with rich experi- opposite Armapore gate early over a report to the President Covid. However, due to the efforts
ence which would prove to be Thursday morning. comprising initiatives taken by of their medical team these
their forte once they joined any One of their accomplices GMC in Covid-19 phase. mothers recovered from the
business house. managed to escape during the President thanked the doctors for disease, he said. Dr Nath added
He said the aim of the police raid. their efforts during the Covid cri- that more than 3,891 patients
industrial visit was to provide Station House Officer sis and also appreciated GMC Principal Dr had recovered from Covid. The GMC had pro-
an exposure to students of the Janardan Pratap Singh said the Dwijendra Nath for his management skills and duced more than 10,000 litres of sanitisers and
practical working environment. accused had also attempted to care of Covid patients. Giving details, Dr Nath installed 20 ventilators for patients, he said.
He said industrial visit had remove cash from the Union
³4]bdaTcX\T[hPePX[PQX[Xch^UUTacX[XbTabbTTSb´
its own importance in the CWTQPcRW^UbcdST]c^U67B8;D2:=>Fk5A830H kC8Q =4F34;78 Based on the tests on ham- Based on these findings, a sor and director of the . particularly important now as clofazimine had less lung dam- COVID-19.
sters—an animal model for Phase 2 study evaluating clo- Immunity and Pathogenesis we see new variants of the virus age and lower viral load, espe- “Potentially most impor-
he US Food and Drug Covid-19, the scientists found fazimine as an at-home treat- Program at Sanford Burnham "/ / emerge and against which the cially when receiving the drug tantly, clofazimine appears to
T Administration (FDA)- that clofazimine lowered the ment for Covid-19 is on the Prebys. " ! current vaccines appear less before infection,” said co- have pan-coronavirus activity,
approved leprosy drug, clofaz- amount of virus in the lungs, anvil anytime soon, said a “We hope to test clofaz- /2 efficacious.” author Ren Sun, professor at indicating it could be an
imine, which is on the World including when given to study published in the journal imine in a Phase 2 clinical trial Discovered in 1954 and the University of Hong Kong important weapon against
Health Organization’s list of healthy animals prior to infec- nature. as soon as possible for people !! used to treat leprosy, and professor at the University future pandemics,” said co-
Essential Medicines, has been tion (prophylactically). The “Clofazimine is an ideal who test positive for COVID- /3 Clofazimine was initially iden- of California, Los Angeles senior author Kwok-Yung
found to have antiviral activi- drug also reduced lung dam- candidate for a Covid-19 treat- 19 but are not hospitalised. " tified by screening one of the (UCLA). Yuen, chair of Infectious
ties against SARS-CoV-2 and age and prevented “cytokine ment. It is safe, affordable, Since there is currently no ! world’s largest collections of Clofazimine also worked Diseases at the University of
initial trials show that it pre- storm,” an overwhelming easy to make, taken as a pill outpatient treatment available known drugs for their ability to synergistically with remde- Hong Kong, who discovered
vents the exaggerated inflam- inflammatory response to and can be made globally for these individuals, clofaz- ! block the replication of SARS- sivir, the current standard-of- the coronavirus that causes
matory response associated SARS-CoV-2 that can be dead- available,” said co-senior imine may help reduce the (454 CoV-2. care treatment for people who severe acute respiratory syn-
with severe Covid-19. ly. author Sumit Chanda, profes- impact of the disease, which is “The animals that received are hospitalised due to drome (SARS).;D2:=>Fk5A830H k=C8=D435A>
;D2:=>Fk5A830H k (
913DB51Z 9C==@ PUX[\c^cWTPdSXT]RTXb 85B31>35B21DD;D2:=>Fk5A830H k=0C8>=0;B 20/2, Atul 22/2, Yash 30/2)
UP Blind and Para Judo Association is organising the 9th AIC: 185 (Sufiyan 60, Ajeet 49, Amit Chopra 38, Shivam 21; Milan
National Blind and Deaf Judo Championships from March 19 36/3)
KD Singh ‘Babu’ Stadium on Thursday. The championship will
be organised in sub-junior, junior boy’s and girl’s, men’s and D=38?7H BRIEF SCORES:
Akhil Infra Club defeated Dhruv Cricket Academy by five D?1[X]SP]S?PaP9dS^0bb^RXPcX^]RWPXa\P]0fP]XbW0fPbcWXP]SVT]TaP[ MT: 188 (Lokesh 72, Sourabh 26, Deepak 26; Chandrashekhar
wickets to lift the BBD Super League trophy at Akhilesh Das bTRaTcPahYou can also read
